Walker-miller Energy Services Llc

Contractor in Detroit, MI.

Unclaimed listing. Are you Walker-miller Energy Services Llc? Claim it free →

About this contractor

License type
Residential Energy Auditor
License #
MSHDA-WALKERMILLERENERGYSERVICESLLC
License status
Active
Service area
Detroit, MI
Phone
Subscribe to view

Information sourced from public state license records — not yet verified by the business owner. Always confirm credentials before hiring.

Is this your business?

This listing was created from public license records. The owner hasn’t claimed it yet — claim it now and we’ll build you a free professional website at bidroom.io/pro/walker-miller-energy-services-llc.

  • Free professional website with photos, services, and booking
  • Matched job leads in Detroit — no per-lead fees
  • Verified-pro badge on your profile
  • Use your own domain (yourbusiness.com) on Pro plan
Claim this profile — Free
No credit card · 60 seconds · You stay in control
← Back to Contractor in Detroit

🔒Unlock contact + message Walker-miller Energy Services Llc in-app

Phone, email, and website are locked for this listing. Subscribe to Bidroom to unlock contact info across our 1.6M-contractor directory and message verified pros directly inside the app.

Subscribe to unlock Or start a 7-day free trial