Overhead Lines, Llc

Contractor in Detroit, MI.

Hiring a contractor in Detroit? Compare quotes from 3 verified contractors in your area — free, no obligation, ~60 seconds.
Get free quotes →
Unclaimed listing. Are you Overhead Lines, Llc? Claim it free →

About this contractor

License type
OSHA_Establishment
License #
OSHA-d84e0da750100d
Classification
Alternative energy (e.g., geothermal, ocean wave, solar, wind) structure construction
Service area
Detroit, MI 48217

Information sourced from public state license records — not yet verified by the business owner. Always confirm credentials before hiring.

Is this your business?

This listing was created from public license records. The owner hasn’t claimed it yet — claim it now and we’ll build you a free professional website at bidroom.io/pro/overhead-lines-llc.

  • Free professional website with photos, services, and booking
  • Matched job leads in Detroit — no per-lead fees
  • Verified-pro badge on your profile
  • Use your own domain (yourbusiness.com) on Pro plan
Claim this profile — Free
No credit card · 60 seconds · You stay in control
← Back to Contractor in Detroit

🔒See Overhead Lines, Llc's phone, email & website — free

Contact info is revealed to anyone with a free Bidroom account. Create yours to unlock contact details across our 1.6M-contractor directory — then subscribe if you'd like to message verified pros directly inside the app.

Create a free account Or subscribe to message in-app

Verify Overhead Lines, Llc before you hire

Bidroom indexed this listing from public Michigan license records. Before signing a contract, take 2 minutes to verify the credentials yourself using the official sources below.

A valid license number on file doesn't guarantee current status. License standing can change — always verify on the state board the day you hire.

Frequently asked about Overhead Lines, Llc

What does Overhead Lines, Llc do?

Overhead Lines, Llc is a contractor based in Detroit, Michigan. Their license classification is Alternative energy (e.g., geothermal, ocean wave, solar, wind) structure construction.

Is Overhead Lines, Llc licensed?

Yes. Overhead Lines, Llc holds Michigan LARA license #OSHA-d84e0da750100d. Verify the current status on Michigan LARA before hiring.

Where is Overhead Lines, Llc located?

Overhead Lines, Llc is based in Detroit, MI 48217. Most contractors serve a 25–50 mile radius from their home base, but always confirm coverage before requesting a bid.

How do I contact Overhead Lines, Llc?

Contact information (phone, email, website) is shown to anyone with a free Bidroom account. Create a free account to reveal Overhead Lines, Llc's contact details, then subscribe if you'd like to message them in-app.

How do I get a quote from Overhead Lines, Llc?

The fastest way is to post your project on Bidroom — Overhead Lines, Llc and up to 2 other verified contractors in Detroit can bid on it, and every quote includes itemized pricing + a written scope of work.

How much does a contractor cost in Detroit?

Varies by scope varies is the typical range. Contractor pricing depends heavily on project size, materials, and access. Get at least 3 itemized written quotes before deciding. Local market rates in Detroit may run higher than this baseline.

Is Overhead Lines, Llc verified on Bidroom?

Not yet. This listing was created from public Michigan license records but hasn't been claimed by the owner. The license info above is from official records, but the business hasn't confirmed its services, hours, or current availability with us yet.

Before you hire a contractor in Detroit

Quick checklist any homeowner can use — these are the 8 things that distinguish hiring well from getting burned.

1Get at least 3 written quotes

Itemized scope + materials + timeline. One quote is a guess; three is data.

2Verify the license is active

Look up the number directly on Michigan LARA — not just a screenshot from the contractor.

3Request a current Certificate of Insurance

General liability AND workers' comp. Have the insurer email it directly — never accept a PDF from the contractor.

4Ask for 3 recent references

Same trade, same scope, completed in the last 12 months. Call them.

5Get a written contract

Scope, payment schedule, start & completion dates, change-order process, warranty terms.

6Never pay 100% upfront

Standard: 10–30% deposit, progress draws tied to milestones, final 10% on punch-list completion.

7Use lien waivers

Get a conditional waiver with every payment and an unconditional waiver at final payment. Protects your title.

8Confirm permits are pulled

For anything structural, electrical, plumbing, or HVAC — the contractor (not you) pulls the permit. No permit = no recourse if work fails inspection.

Skip the "find 3 contractors" homework. Post your project once. Get matched with 3 licensed contractors in Detroit who actually want the work. Free.
Post your project →

Contractor costs in Detroit, MI

Typical varies
Varies by scope

Contractor pricing depends heavily on project size, materials, and access. Get at least 3 itemized written quotes before deciding.

Ranges are national averages. Detroit market rates may run 10–30% higher in high-cost metros. Get itemized bids to compare apples-to-apples.

Other contractors in Detroit

Go Green Contracting Inc.
Detroit, MI · License #MSHDA-GOGREENCONTRACTINGINC
Unclaimed
Walker-miller Energy Services Llc
Detroit, MI · License #MSHDA-WALKERMILLERENERGYSERVICESLLC
Unclaimed
Ampro Construction
Detroit, MI · License #BBB-32002174
Unclaimed
Salazar Drywall
Detroit, MI · License #BBB-90023361
Unclaimed
A-team Outdoor Services
Detroit, MI · License #BBB-90035353
Unclaimed
Q & A Corporation Group
Detroit, MI · License #BBB-90050853
Unclaimed
View all contractors in Detroit →

Other trades hiring in Detroit

Are you Overhead Lines, Llc?Claim this profile free and we'll build you a professional website at bidroom.io/pro/overhead-lines-llc — photos, services, online booking, your own domain.
Claim free →